HORDB

General Information

ID: hor006561
Uniprot ID: P84715
Protein name: C-type natriuretic peptide 39
Gene name: NA
Organism: Ornithorhynchus anatinus (Duckbill platypus)
Family: Natriuretic peptide family
Source: animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Ornithorhynchus (genus), Ornithorhynchidae (family), Monotremata (order), Prototheria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005267 potassium channel activity; GO:0005272 sodium channel activity; GO:0051427 hormone receptor binding; GO:0090729 toxin activity
GO BP: GO:0006182 cGMP biosynthetic process; GO:0006811 monoatomic ion transport; GO:0006813 potassium ion transport; GO:0006814 sodium ion transport; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0008217 regulation of blood pressure; GO:0034220 monoatomic ion transmembrane transport; GO:0035725 sodium ion transmembrane transport; GO:0035896 positive regulation of mast cell degranulation in another organism; GO:0042311 vasodilation; GO:0044398 envenomation resulting in induction of edema in another organism; GO:0044619 positive regulation of relaxation of uterine smooth muscle in another organism; GO:0071805 potassium ion transmembrane transport; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence Information

Sequence: LLHDHPNPRKYKPANKKGLSKGCFGLKLDRIGSTSGLGC
Length: 39
Propeptide: MHLSHLLAWALLLTLLSLRAEAKPPSPQPQVPRSPGDEASEAVAANGGGKKGDKEPKGDRPRLLRELRLDTRSRGSRGVWTRLLHDHPNPRKYKPANKKGLSKGCFGLKLDRIGSTSGLGC
Signal peptide: MHLSHLLAWALLLTLLSLRAEA
Modification: T2 D-leucine
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Venom component with vasorelaxant activity. In vitro stimulates the production of cGMP in rat aortic smooth muscle cells and histamine release from rat peritoneal mast cells. Induces relaxation of isolated rat uterus. Induces local edema following subplantar injection into rat hind paw. Forms voltage-dependent cation channels which are weakly selective for potassium relative to sodium, and whose conductance decreases with increasing dehydration energy of the monovalent cation. The activity of the fast cation channels is calcium dependent and is characterized by short bursts of current separated by long periods of inactivation. ; Venom peptide 1 induces slow and continuous calcium influx in IMR-32 human neuroblastoma cells. Venom peptide 4 weakly induces calcium influx in IMR-32 human neuroblastoma cells while venom peptide 2 was not observed to induce calcium influx.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P84715-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006561_AF2.pdb

hor006561_ESM.pdb

Physical Information

Mass:	488592	Formula:	C185H305N57O51S2
Absent amino acids:	EMQVW	Common amino acids:	GKL
pI:	10.58	Basic residues:	10
Polar residues:	15	Hydrophobic residues:	9
Hydrophobicity:	-70.51	Boman Index:	-6866
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	72.56
Instability Index:	476.92	Extinction Coefficient cystines:	1615
Absorbance 280nm:	42.5

Literature

PubMed ID: 18464734
Title: Genome analysis of the platypus reveals unique signatures of evolution.
PubMed ID: 19928958
Title: Duck-billed platypus venom peptides induce Ca2+ influx in neuroblastoma cells.
PubMed ID: 9827022
Title: A C-type natriuretic peptide from the venom of the platypus (Ornithorhynchus anatinus): structure and pharmacology.
PubMed ID: 7597719
Title: A pharmacological and biochemical investigation of the venom from the platypus (Ornithorhynchus anatinus).
PubMed ID: 9663691
Title: The natriuretic peptide (ovCNP-39) from platypus (Ornithorhynchus anatinus) venom relaxes the isolated rat uterus and promotes oedema and mast cell histamine release.
PubMed ID: 10409107
Title: Calcium dependence of C-type natriuretic peptide-formed fast K(+) channel.
PubMed ID: 10381585
Title: Characterization of a C-type natriuretic peptide (CNP-39)-formed cation-selective channel from platypus (Ornithorhynchus anatinus) venom.
PubMed ID: 12135762
Title: D-Amino acid residue in the C-type natriuretic peptide from the venom of the mammal, Ornithorhynchus anatinus, the Australian platypus.
PubMed ID: 12175607
Title: Conformations of platypus venom C-type natriuretic peptide in aqueous solution and sodium dodecyl sulfate micelles.